PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G017087_P02
Common NameKN-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TALE
Protein Properties Length: 359aa    MW: 39826.7 Da    PI: 6.9083
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G017087_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox261.6e-082883222155
                        HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
           Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        k +yps++++  LA+++gL+ +q+ +WF N+R ++
  GRMZM2G017087_P02 288 KWPYPSETQKVALAESTGLDLKQINNWFINQRKRH 322
                        569*****************************885 PP

2ELK37.16.7e-13242263122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        ELKh+Ll+KYsgyL+sLkqE+s
  GRMZM2G017087_P02 242 ELKHHLLKKYSGYLSSLKQELS 263
                        9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-18102146IPR005540KNOX1
PfamPF037901.1E-21103144IPR005540KNOX1
SMARTSM012561.9E-27153204IPR005541KNOX2
PfamPF037919.0E-23159202IPR005541KNOX2
SMARTSM01188570162182IPR005539ELK domain
PfamPF037898.1E-10242263IPR005539ELK domain
PROSITE profilePS5121311.331242262IPR005539ELK domain
SMARTSM011884.9E-7242263IPR005539ELK domain
PROSITE profilePS5007112.698262325IPR001356Homeobox domain
SuperFamilySSF466897.7E-20263337IPR009057Homeodomain-like
SMARTSM003891.6E-12264329IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-28267327IPR009057Homeodomain-like
CDDcd000862.61E-12274326No hitNo description
PfamPF059201.2E-16282321IPR008422Homeobox KN domain
PROSITE patternPS000270300323IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MEEITQHFGV GASSHGHGHG QHHHHHHHHH PWASSLSAVV APLPPQPPSA GLPLTLNTVA  60
ATGNSGGSGN PVLQLANGGG LLDACVKAKE PSSSSPYAGD VEAIKAKIIS HPHYYSLLTA  120
YLECNKVGAP PEVSARLTEI AQEVEARQRT ALGGLAAATE PELDQFMEAY HEMLVKFREE  180
LTRPLQEAME FMRRVESQLN SLSISGRSLR NILSSGSSEE DQEGSGGETE LPEVDAHGVD  240
QELKHHLLKK YSGYLSSLKQ ELSKKKKKGK LPKEARQQLL SWWDQHYKWP YPSETQKVAL  300
AESTGLDLKQ INNWFINQRK RHWKPSEEMH HLMMDGYHTT NAFYMDGHFI NDGGLYRLG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.947100.0ear| meristem| ovary| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G017087
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout apical and vegetative meristem during development. Down-regulated as leaves and floral organs are initiated. {ECO:0000269|PubMed:1362381}.
UniprotTISSUE SPECIFICITY: Expressed in apical meristems of vegetative and floral stems as well as in the underlying ground meristem. Specifically expressed in vascular bundles developing both in the leaf and stem. Very low levels of expression in leaves.
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription factor that regulates genes involved in development. Mutations in KN-1 alter leaf development. Foci of cells along the lateral vein do not differentiate properly but continue to divide, forming knots. May participate in the switch from indeterminate to determinate cell fates. Probably binds to the DNA sequence 5'-TGAC-3'.
Function -- GeneRIF ? help Back to Top
  1. kn1 and td1 function in a pathway to maintain meristem homeostasis but their products may interact with different partners during development.
    [PMID: 19153258]
  2. KN1 negatively modulates the accumulation of gibberellin (GA) through the control of ga2ox1.
    [PMID: 19567707]
  3. kn1 normally participates in the establishment of proximal/distal polarity in the incipient leaf.
    [PMID: 19854860]
  4. KN1 trafficking requires chaperonin complex; study shows chaperonins are essential for cell-to-cell trafficking of subset of mobile transcription factors and demonstrates importance of chaperonin-dependent protein trafficking for plant stem cell function
    [PMID: 21868675]
  5. It was shown that knotted1 plays a key role in orchestrating the upper levels of a hierarchical gene regulatory network that impacts plant meristem identity and function.
    [PMID: 22855831]
  6. Analysis of combinatorial binding with stem cell regulator, KNOTTED1 models for RA1 in promoting determinacy.
    [PMID: 24307553]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqSRX158000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G017087_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9619520.0EU961952.1 Zea mays clone 239250 homeobox protein OSH1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105436.10.0homeotic protein knotted-1
SwissprotP243450.0KN1_MAIZE; Homeotic protein knotted-1
TrEMBLQ53ZF10.0Q53ZF1_MAIZE; Homeobox protein
STRINGGRMZM2G017087_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.16e-91KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Smith LG,Greene B,Veit B,Hake S
    A dominant mutation in the maize homeobox gene, Knotted-1, causes its ectopic expression in leaf cells with altered fates.
    Development, 1992. 116(1): p. 21-30
    [PMID:1362381]
  2. Vollbrecht E,Veit B,Sinha N,Hake S
    The developmental gene Knotted-1 is a member of a maize homeobox gene family.
    Nature, 1991. 350(6315): p. 241-3
    [PMID:1672445]
  3. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  4. Lunde C,Hake S
    The interaction of knotted1 and thick tassel dwarf1 in vegetative and reproductive meristems of maize.
    Genetics, 2009. 181(4): p. 1693-7
    [PMID:19153258]
  5. Bolduc N,Hake S
    The maize transcription factor KNOTTED1 directly regulates the gibberellin catabolism gene ga2ox1.
    Plant Cell, 2009. 21(6): p. 1647-58
    [PMID:19567707]
  6. Ramirez J,Bolduc N,Lisch D,Hake S
    Distal expression of knotted1 in maize leaves leads to reestablishment of proximal/distal patterning and leaf dissection.
    Plant Physiol., 2009. 151(4): p. 1878-88
    [PMID:19854860]
  7. Woodward JB, et al.
    A maize thiamine auxotroph is defective in shoot meristem maintenance.
    Plant Cell, 2010. 22(10): p. 3305-17
    [PMID:20971897]
  8. Veit B,Vollbrecht E,Mathern J,Hake S
    A tandem duplication causes the Kn1-O allele of Knotted, a dominant morphological mutant of maize.
    Genetics, 1990. 125(3): p. 623-31
    [PMID:2165968]
  9. Xu XM, et al.
    Chaperonins facilitate KNOTTED1 cell-to-cell trafficking and stem cell function.
    Science, 2011. 333(6046): p. 1141-4
    [PMID:21868675]
  10. Bolduc N, et al.
    Unraveling the KNOTTED1 regulatory network in maize meristems.
    Genes Dev., 2012. 26(15): p. 1685-90
    [PMID:22855831]
  11. Eveland AL, et al.
    Regulatory modules controlling maize inflorescence architecture.
    Genome Res., 2014. 24(3): p. 431-43
    [PMID:24307553]
  12. Meisel L,Lam E
    The conserved ELK-homeodomain of KNOTTED-1 contains two regions that signal nuclear localization.
    Plant Mol. Biol., 1996. 30(1): p. 1-14
    [PMID:8616227]